Albumin antibody (N-Term)

Catalog No. ABIN633959

Product Details anti-Albumin Antibody

Target: Albumin (ALB)

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Albumin antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Albumin antibody was raised against the N terminal of ALB

Purification: Affinity purified

Immunogen: Albumin antibody was raised using the N terminal of ALB corresponding to a region with amino acids YGEMADCCAKQEPERNECFLQHKDDNPNLPRLVRPEVDVMCTAFHDNEET

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Albumin Blocking Peptide, catalog no. 33R-10104, is also available for use as a blocking control in assays to test for specificity of this Albumin antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

References for anti-Albumin antibody (ABIN633959)

Canuel, Bhattacharyya, Balbis, Yuan, Morales: "Sortilin and prosaposin localize to detergent-resistant membrane microdomains." in: Experimental cell research, Vol. 315, Issue 2, pp. 240-7, (2008) (PubMed).

Clavant, Sastra, Osicka, Comper: "The analysis and characterisation of immuno-unreactive urinary albumin in healthy volunteers." in: Clinical biochemistry, Vol. 39, Issue 2, pp. 143-51, (2006) (PubMed).

Target Details for Albumin

Target: Albumin (ALB)

Alternative Name: Albumin (ALB Products)

Background: Albumin is a soluble, monomeric protein which comprises about one-half of the blood serum protein. Albumin functions primarily as a carrier protein for steroids, fatty acids, and thyroid hormones and plays a role in stabilizing extracellular fluid volume. Albumin is a globular unglycosylated serum protein of molecular weight 65,000. Albumin is synthesized in the liver as preproalbumin which has an N-terminal peptide that is removed before the nascent protein is released from the rough endoplasmic reticulum. The product, proalbumin, is in turn cleaved in the Golgi vesicles to produce the secreted albumin.

Molecular Weight: 66 kDa (MW of target protein)

Pathways: Lipid Metabolism