FUT6 antibody (C-Term)
-
- Target See all FUT6 Antibodies
- FUT6 (Fucosyltransferase 6 (Alpha (1,3) Fucosyltransferase) (FUT6))
-
Binding Specificity
- C-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This FUT6 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- FUT6 antibody was raised against the C terminal of FUT6
- Purification
- Affinity purified
- Immunogen
- FUT6 antibody was raised using the C terminal of FUT6 corresponding to a region with amino acids YITEKLWRNALEAWAVPVVLGPSRSNYERFLPPDAFIHVDDFQSPKDLAR
- Top Product
- Discover our top product FUT6 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
FUT6 Blocking Peptide, catalog no. 33R-10142, is also available for use as a blocking control in assays to test for specificity of this FUT6 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FUT6 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FUT6 (Fucosyltransferase 6 (Alpha (1,3) Fucosyltransferase) (FUT6))
- Alternative Name
- FUT6 (FUT6 Products)
- Background
- FUT6 is a Golgi stack membrane protein that is involved in the creation of sialyl-Lewis X, an E-selectin ligand. Mutations in this gene are a cause of fucosyltransferase-6 deficiency. The protein encoded by this gene is a Golgi stack membrane protein that is involved in the creation of sialyl-Lewis X, an E-selectin ligand. Mutations in this gene are a cause of fucosyltransferase-6 deficiency. Two transcript variants encoding the same protein have been found for this gene.
- Molecular Weight
- 42 kDa (MW of target protein)
-