FUT6 antibody (C-Term)

Catalog No. ABIN633952

Product Details anti-FUT6 Antibody

Target: FUT6 (Fucosyltransferase 6 (Alpha (1,3) Fucosyltransferase) (FUT6))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FUT6 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: FUT6 antibody was raised against the C terminal of FUT6

Purification: Affinity purified

Immunogen: FUT6 antibody was raised using the C terminal of FUT6 corresponding to a region with amino acids YITEKLWRNALEAWAVPVVLGPSRSNYERFLPPDAFIHVDDFQSPKDLAR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FUT6 Blocking Peptide, catalog no. 33R-10142, is also available for use as a blocking control in assays to test for specificity of this FUT6 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FUT6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FUT6

Target: FUT6 (Fucosyltransferase 6 (Alpha (1,3) Fucosyltransferase) (FUT6))

Alternative Name: FUT6 (FUT6 Products)

Synonyms: FCT3A antibody, FT1A antibody, Fuc-TVI antibody, FucT-VI antibody, FUT3 antibody, fut antibody, FUT antibody, FUTB antibody, ATFUT6 antibody, F7A19.16 antibody, F7A19_16 antibody, fucosyltransferase 6 antibody, fut6 antibody, fucosyltransferase 6 antibody, fucosyltransferase 6 S homeolog antibody, FUT6 antibody, fut6.S antibody

Background: FUT6 is a Golgi stack membrane protein that is involved in the creation of sialyl-Lewis X, an E-selectin ligand. Mutations in this gene are a cause of fucosyltransferase-6 deficiency. The protein encoded by this gene is a Golgi stack membrane protein that is involved in the creation of sialyl-Lewis X, an E-selectin ligand. Mutations in this gene are a cause of fucosyltransferase-6 deficiency. Two transcript variants encoding the same protein have been found for this gene.

Molecular Weight: 42 kDa (MW of target protein)