WFDC5 antibody (N-Term)

Catalog No. ABIN633949

Product Details anti-WFDC5 Antibody

Target: WFDC5 (WAP Four-Disulfide Core Domain 5 (WFDC5))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This WFDC5 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: WFDC5 antibody was raised against the N terminal of WFDC5

Purification: Affinity purified

Immunogen: WFDC5 antibody was raised using the N terminal of WFDC5 corresponding to a region with amino acids MRTQSLLLLGALLAVGSQLPAVFGRKKGEKSGGCPPDDGPCLLSVPDQCV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

WFDC5 Blocking Peptide, catalog no. 33R-6386, is also available for use as a blocking control in assays to test for specificity of this WFDC5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WFDC5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for WFDC5

Target: WFDC5 (WAP Four-Disulfide Core Domain 5 (WFDC5))

Alternative Name: WFDC5 (WFDC5 Products)

Synonyms: Prg5 antibody, Wap1 antibody, BC019734 antibody, PRG5 antibody, WAP1 antibody, dJ211D12.5 antibody, WAP four-disulfide core domain 5 antibody, Wfdc5 antibody, WFDC5 antibody

Background: This gene encodes a member of the WAP-type four-disulfide core (WFDC) domain family. Most WFDC proteins contain only one WFDC domain, and this encoded protein contains two WFDC domains. The WFDC domain, or WAP signature motif, contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor. Most WFDC gene members are localized to chromosome 20q12-q13 in two clusters: centromeric and telomeric. This gene belongs to the centromeric cluster.

Molecular Weight: 11 kDa (MW of target protein)