AER61 antibody (C-Term)

Catalog No. ABIN633948

Product Details anti-AER61 Antibody

Target: AER61 (C3orf64) (Chromosome 3 Open Reading Frame 64 (C3orf64))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This AER61 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: C3 ORF64 antibody was raised against the C terminal Of C3 rf64

Purification: Affinity purified

Immunogen: C3 ORF64 antibody was raised using the C terminal Of C3 rf64 corresponding to a region with amino acids GHHPTLGEHPKFTNYSFDVEEFMYLVLQAADHVLQHPKWPFKKKHDEL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C3ORF64 Blocking Peptide, catalog no. 33R-3308, is also available for use as a blocking control in assays to test for specificity of this C3ORF64 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF64 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for AER61

Target: AER61 (C3orf64) (Chromosome 3 Open Reading Frame 64 (C3orf64))

Alternative Name: C3ORF64 (C3orf64 Products)

Synonyms: AER61 antibody, aer61 antibody, c3orf64 antibody, C12H3orf64 antibody, EOGT antibody, C22H3orf64 antibody, AOS4 antibody, C3orf64 antibody, EOGT1 antibody, A130022J15Rik antibody, AI447490 antibody, AW214473 antibody, AW259391 antibody, Aer61 antibody, EGF domain specific O-linked N-acetylglucosamine transferase antibody, glycosyltransferase aer61 antibody, EGF domain-specific O-linked N-acetylglucosamine (GlcNAc) transferase antibody, EGF domain-specific O-linked N-acetylglucosamine (GlcNAc) transferase L homeolog antibody, EOGT antibody, aer61 antibody, eogt antibody, eogt.L antibody, Eogt antibody

Background: The function of C3orf64 protein has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 52 kDa (MW of target protein)