AER61 antibody (C-Term)

Catalog No. ABIN633948

Product Details anti-AER61 Antibody

Target: AER61 (C3orf64) (Chromosome 3 Open Reading Frame 64 (C3orf64))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This AER61 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: C3 ORF64 antibody was raised against the C terminal Of C3 rf64

Purification: Affinity purified

Immunogen: C3 ORF64 antibody was raised using the C terminal Of C3 rf64 corresponding to a region with amino acids GHHPTLGEHPKFTNYSFDVEEFMYLVLQAADHVLQHPKWPFKKKHDEL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C3ORF64 Blocking Peptide, catalog no. 33R-3308, is also available for use as a blocking control in assays to test for specificity of this C3ORF64 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF64 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for AER61

Target: AER61 (C3orf64) (Chromosome 3 Open Reading Frame 64 (C3orf64))

Alternative Name: C3ORF64 (C3orf64 Products)

Background: The function of C3orf64 protein has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 52 kDa (MW of target protein)