GALNT10 antibody (N-Term)
-
- Target See all GALNT10 Antibodies
- GALNT10 (UDP-N-Acetyl-alpha-D-Galactosamine:polypeptide N-Acetylgalactosaminyltransferase 10 (GalNAc-T10) (GALNT10))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This GALNT10 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- GALNT10 antibody was raised against the N terminal Of Galnt10
- Purification
- Affinity purified
- Immunogen
- GALNT10 antibody was raised using the N terminal Of Galnt10 corresponding to a region with amino acids VPAGVSLARNLKRVAEVWMDEYAEYIYQRRPEYRHLSAGDVAVQKKLRSS
- Top Product
- Discover our top product GALNT10 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
GALNT10 Blocking Peptide, catalog no. 33R-9717, is also available for use as a blocking control in assays to test for specificity of this GALNT10 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GALNT10 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GALNT10 (UDP-N-Acetyl-alpha-D-Galactosamine:polypeptide N-Acetylgalactosaminyltransferase 10 (GalNAc-T10) (GALNT10))
- Alternative Name
- GALNT10 (GALNT10 Products)
- Synonyms
- AU018154 antibody, C330012K04Rik antibody, GalNAc-T10 antibody, GalNAc-T9 antibody, Galnt9 antibody, ppGaNTase antibody, wu:fb37e08 antibody, zgc:153114 antibody, GALNACT10 antibody, PPGALNACT10 antibody, PPGANTASE10 antibody, polypeptide N-acetylgalactosaminyltransferase 10 antibody, UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 10 (GalNAc-T10) antibody, Galnt10 antibody, galnt10 antibody, GALNT10 antibody
- Background
- GALNT10 belongs to the polypeptide N-acetylgalactosaminyltransferase (pp-GalNAc-T) family. Polypeptide GalNAc transferases initiate the synthesis of mucin-type oligosaccharides by transferring GalNAc from UDP-GalNAc to the hydroxyl group of either a serine or threonine residue on the polypeptide acceptor. Following expression in insect cells, recombinant GalNAc transferase 10 showed significant GalNAcT activity toward mucin-derived peptides, and it utilized both nonglycosylated and glycosylated peptide substrates.
- Molecular Weight
- 31 kDa (MW of target protein)
-