SMPDL3B antibody (N-Term)
-
- Target See all SMPDL3B Antibodies
- SMPDL3B (Sphingomyelin phosphodiesterase, Acid-Like 3B (SMPDL3B))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SMPDL3B antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- SMPDL3 B antibody was raised against the N terminal of SMPDL3
- Purification
- Affinity purified
- Immunogen
- SMPDL3 B antibody was raised using the N terminal of SMPDL3 corresponding to a region with amino acids ILWTGDDTPHVPDEKLGEAAVLEIVERLTKLIREVFPDTKVYAALGNHDF
- Top Product
- Discover our top product SMPDL3B Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SMPDL3B Blocking Peptide, catalog no. 33R-4064, is also available for use as a blocking control in assays to test for specificity of this SMPDL3B antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SMPDL0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SMPDL3B (Sphingomyelin phosphodiesterase, Acid-Like 3B (SMPDL3B))
- Alternative Name
- SMPDL3B (SMPDL3B Products)
- Background
- Located on chromosome 1, this gene encodes for acid sphingomyelinase-like phosphodiesterase 3b precursor protein.
- Molecular Weight
- 52 kDa (MW of target protein)
-