UGCGL2 antibody (N-Term)

Catalog No. ABIN633912

Product Details anti-UGCGL2 Antibody

Target: UGCGL2 (UGT2) (UDP-Glucose Glycoprotein Glucosyltransferase 2 (UGT2))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This UGCGL2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: UGCGL2 antibody was raised against the N terminal of µgCGL2

Purification: Affinity purified

Immunogen: UGCGL2 antibody was raised using the N terminal of µgCGL2 corresponding to a region with amino acids KHTCKINEIKKLLKKAASRTRPYLFKGDHKFPTNKENLPVVILYAEMGTR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

UGCGL2 Blocking Peptide, catalog no. 33R-4422, is also available for use as a blocking control in assays to test for specificity of this µgCGL2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of µgCGL2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for UGCGL2

Target: UGCGL2 (UGT2) (UDP-Glucose Glycoprotein Glucosyltransferase 2 (UGT2))

Alternative Name: UGCGL2 (UGT2 Products)

Synonyms: UGCGL2 antibody, ugcgl2 antibody, im:7146988 antibody, wu:fi13a08 antibody, HUGT2 antibody, UGT2 antibody, 1810064L21Rik antibody, 3110001A05Rik antibody, 3110027P15Rik antibody, A230065J02Rik antibody, AW047562 antibody, Ugcgl2 antibody, UDP-glucose glycoprotein glucosyltransferase 2 antibody, UGGT2 antibody, uggt2 antibody, Uggt2 antibody

Background: UGCGL2 recognises glycoproteins with minor folding defects. UGCGL2 reglucosylates single N-glycans near the misfolded part of the protein, thus providing quality control for protein folding in the endoplasmic reticulum. Reglucosylated proteins are recognised by calreticulin for recycling to the endoplasmic reticulum and refolding or degradation.

Molecular Weight: 172 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome