XPNPEP2 antibody

Catalog No. ABIN633909

Product Details anti-XPNPEP2 Antibody

Target: XPNPEP2 (X-Prolyl Aminopeptidase (Aminopeptidase P) 2, Membrane-Bound (XPNPEP2))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This XPNPEP2 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: XPNPEP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids QALLKASHVRDAVAVIRYLVWLEKNVPKGTVDEFSGAEIVDKFRGEEQFS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

XPNPEP2 Blocking Peptide, catalog no. 33R-7464, is also available for use as a blocking control in assays to test for specificity of this XPNPEP2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of XPNPEP2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for XPNPEP2

Target: XPNPEP2 (X-Prolyl Aminopeptidase (Aminopeptidase P) 2, Membrane-Bound (XPNPEP2))

Alternative Name: XPNPEP2 (XPNPEP2 Products)

Synonyms: APP2 antibody, 9030008G12Rik antibody, mAPP antibody, XPNPEP2 antibody, zK61O11.1 antibody, zgc:63528 antibody, X-prolyl aminopeptidase 2 antibody, X-prolyl aminopeptidase (aminopeptidase P) 2, membrane-bound antibody, X-prolyl aminopeptidase (aminopeptidase P) 2, membrane-bound L homeolog antibody, XPNPEP2 antibody, Xpnpep2 antibody, xpnpep2.L antibody, xpnpep2 antibody

Background: Aminopeptidase P is a hydrolase specific for N-terminal imido bonds, which are common to several collagen degradation products, neuropeptides, vasoactive peptides, and cytokines. Structurally, the enzyme is a member of the 'pita bread fold' family and occurs in mammalian tissues in both soluble and GPI-anchored membrane-bound forms. A membrane-bound and soluble form of this enzyme has been identified as products of two separate genes.

Molecular Weight: 75 kDa (MW of target protein)