REG1B antibody (N-Term)

Catalog No. ABIN633906

Product Details anti-REG1B Antibody

Target: REG1B (Regenerating Islet-Derived 1 beta (REG1B))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This REG1B antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: REG1 B antibody was raised against the N terminal of REG1

Purification: Affinity purified

Immunogen: REG1 B antibody was raised using the N terminal of REG1 corresponding to a region with amino acids MAQTNSFFMLISSLMFLSLSQGQESQTELPNPRISCPEGTNAYRSYCYYF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

REG1B Blocking Peptide, catalog no. 33R-5728, is also available for use as a blocking control in assays to test for specificity of this REG1B antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of REG0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for REG1B

Target: REG1B (Regenerating Islet-Derived 1 beta (REG1B))

Alternative Name: REG1B (REG1B Products)

Synonyms: PSPS2 antibody, REGH antibody, REGI-BETA antibody, REGL antibody, regenerating family member 1 beta antibody, REG1B antibody

Background: REG1B might act as an inhibitor of spontaneous calcium carbonate precipitation. REG1B may be associated with neuronal sprouting in brain, and with brain and pancreas regeneration.

Molecular Weight: 16 kDa (MW of target protein)