GFRA2 antibody (C-Term)
-
- Target See all GFRA2 Antibodies
- GFRA2 (GDNF Family Receptor alpha 2 (GFRA2))
-
Binding Specificity
- C-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This GFRA2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- GFRA2 antibody was raised against the C terminal of GFRA2
- Purification
- Affinity purified
- Immunogen
- GFRA2 antibody was raised using the C terminal of GFRA2 corresponding to a region with amino acids NVSPKGPSFQATQAPRVEKTPSLPDDLSDSTSLGTSVITTCTSVQEQGLK
- Top Product
- Discover our top product GFRA2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
GFRA2 Blocking Peptide, catalog no. 33R-6924, is also available for use as a blocking control in assays to test for specificity of this GFRA2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GFRA2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GFRA2 (GDNF Family Receptor alpha 2 (GFRA2))
- Alternative Name
- GFRA2 (GFRA2 Products)
- Synonyms
- GDNFRB antibody, NRTNR-ALPHA antibody, NTNRA antibody, RETL2 antibody, TRNR2 antibody, Retl2 antibody, NTNRALPHA antibody, ntnra antibody, retl2 antibody, trnr2 antibody, gdnfrb antibody, nrtnr-alpha antibody, gfra2 antibody, GDNF family receptor alpha 2 antibody, glial cell line derived neurotrophic factor family receptor alpha 2 antibody, GDNF family receptor alpha 2a antibody, GFRA2 antibody, Gfra2 antibody, gfra2 antibody, gfra2a antibody
- Background
- Glial cell line-derived neurotrophic factor (GDNF) and neurturin (NTN) are two structurally related, potent neurotrophic factors that play key roles in the control of neuron survival and differentiation. GFRA2 is a member of the GDNF receptor family. It is a glycosylphosphatidylinositol(GPI)-linked cell surface receptor for both GDNF and NTN, and mediates activation of the RET tyrosine kinase receptor. This encoded protein acts preferentially as a receptor for NTN compared to its other family member, GDNF family receptor alpha 1.
- Molecular Weight
- 47 kDa (MW of target protein)
-