BCKDHA antibody (N-Term)

Catalog No. ABIN633903

Product Details anti-BCKDHA Antibody

Target: BCKDHA (Branched Chain Keto Acid Dehydrogenase E1, alpha Polypeptide (BCKDHA))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This BCKDHA antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: BCKDHA antibody was raised against the N terminal of BCKDHA

Purification: Affinity purified

Immunogen: BCKDHA antibody was raised using the N terminal of BCKDHA corresponding to a region with amino acids NVISGIPIYRVMDRQGQIINPSEDPHLPKEKVLKLYKSMTLLNTMDRILY

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

BCKDHA Blocking Peptide, catalog no. 33R-6914, is also available for use as a blocking control in assays to test for specificity of this BCKDHA antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BCKDHA antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for BCKDHA

Target: BCKDHA (Branched Chain Keto Acid Dehydrogenase E1, alpha Polypeptide (BCKDHA))

Alternative Name: BCKDHA (BCKDHA Products)

Synonyms: wu:fd20d04 antibody, zgc:110049 antibody, BCKDE1A antibody, MSU antibody, MSUD1 antibody, OVD1A antibody, BCKDA antibody, E1a antibody, 2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial antibody, branched chain keto acid dehydrogenase E1, alpha polypeptide antibody, 2-oxoisovalerate dehydrogenase alpha subunit (branched-chain alpha-keto acid dehydrogenase E1 component alpha chain) (BCKDH E1-alpha) (BCKDE1A) antibody, branched chain ketoacid dehydrogenase E1, alpha polypeptide antibody, LOC704978 antibody, bckdha antibody, BCKDHA antibody, BckdhA antibody, Bckdha antibody

Background: The branched-chain alpha-keto dehydrogenase complex catalyzes the overall conversion of alpha-keto acids to acyl-CoA and CO2. It contains multiple copies of three enzymatic components: branched-chain alpha-keto acid decarboxylase (E1), lipoamide acyltransferase (E2) and lipoamide dehydrogenase (E3).

Molecular Weight: 50 kDa (MW of target protein)