OXCT1 antibody (N-Term)

Catalog No. ABIN633892

Product Details anti-OXCT1 Antibody

Target: OXCT1 (3-Oxoacid CoA Transferase 1 (OXCT1))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This OXCT1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: OXCT1 antibody was raised against the N terminal of OXCT1

Purification: Affinity purified

Immunogen: OXCT1 antibody was raised using the N terminal of OXCT1 corresponding to a region with amino acids TLAERIRAGGAGVPAFYTPTGYGTLVQEGGSPIKYNKDGSVAIASKPREV

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

OXCT1 Blocking Peptide, catalog no. 33R-9158, is also available for use as a blocking control in assays to test for specificity of this OXCT1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OXCT1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for OXCT1

Target: OXCT1 (3-Oxoacid CoA Transferase 1 (OXCT1))

Alternative Name: OXCT1 (OXCT1 Products)

Synonyms: OXCT antibody, oxct1 antibody, zgc:92003 antibody, wu:fj36f06 antibody, wu:fj48g08 antibody, OXCT1 antibody, oxct antibody, scot antibody, SCOT antibody, 2610008O03Rik antibody, Oxct antibody, Oxct2a antibody, Scot-s antibody, 3-oxoacid CoA-transferase 1 antibody, 3-oxoacid CoA transferase 1a antibody, 3-oxoacid CoA transferase 1 antibody, 3-oxoacid CoA-transferase 1 L homeolog antibody, succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial antibody, OXCT1 antibody, oxct1a antibody, oxct1 antibody, Oxct1 antibody, oxct1.L antibody, MONBRDRAFT_35053 antibody, LOC100414476 antibody

Background: OXCT1 is a member of the 3-oxoacid CoA-transferase gene family. It is a homodimeric mitochondrial matrix enzyme that plays a central role in extrahepatic ketone body catabolism by catalyzing the reversible transfer of coenzyme A from succinyl-CoA to acetoacetate.

Molecular Weight: 52 kDa (MW of target protein)

Pathways: Positive Regulation of Peptide Hormone Secretion, Carbohydrate Homeostasis