MRPL47 antibody (Middle Region)

Catalog No. ABIN633887

Product Details anti-MRPL47 Antibody

Target: MRPL47 (Mitochondrial Ribosomal Protein L47 (MRPL47))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MRPL47 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: MRPL47 antibody was raised against the middle region of MRPL47

Purification: Affinity purified

Immunogen: MRPL47 antibody was raised using the middle region of MRPL47 corresponding to a region with amino acids VVQEREDALRLLQTGQERARPGAWRRDIFGRIIWHKFKQWVIPWHLNKRY

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MRPL47 Blocking Peptide, catalog no. 33R-9890, is also available for use as a blocking control in assays to test for specificity of this MRPL47 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MRPL47 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MRPL47

Target: MRPL47 (Mitochondrial Ribosomal Protein L47 (MRPL47))

Alternative Name: MRPL47 (MRPL47 Products)

Synonyms: BcDNA:AT29239 antibody, CG9378 antibody, Dmel\\CG9378 antibody, MRP-L47 antibody, Rlc1 antibody, L47mt antibody, NCM1 antibody, 4833424P18Rik antibody, CGI-204 antibody, ENSMUSG00000051761 antibody, Gm9859 antibody, MTF/L47 antibody, MRPL47 antibody, id:ibd1090 antibody, mitochondrial ribosomal protein L47 antibody, 39S ribosomal protein L47, mitochondrial antibody, mRpL47 antibody, MRPL47 antibody, Mrpl47 antibody, LOC413774 antibody, mrpl47 antibody

Background: Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit.

Molecular Weight: 17 kDa (MW of target protein)