LOXL1 antibody (N-Term)

Catalog No. ABIN633885

Product Details anti-LOXL1 Antibody

Target: LOXL1 (Lysyl Oxidase-Like 1 (LOXL1))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LOXL1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: LOXL1 antibody was raised against the N terminal of LOXL1

Purification: Affinity purified

Immunogen: LOXL1 antibody was raised using the N terminal of LOXL1 corresponding to a region with amino acids RWRQLIQWENNGQVYSLLNSGSEYVPAGPQRSESSSRVLLAGAPQAQQRR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LOXL1 Blocking Peptide, catalog no. 33R-8268, is also available for use as a blocking control in assays to test for specificity of this LOXL1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LOXL1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LOXL1

Target: LOXL1 (Lysyl Oxidase-Like 1 (LOXL1))

Alternative Name: LOXL1 (LOXL1 Products)

Synonyms: LOL antibody, LOXL antibody, Loxl antibody, si:ch211-238c15.1 antibody, lol antibody, loxl antibody, loxl-1 antibody, oxl-1 antibody, lysyl oxidase like 1 antibody, lysyl oxidase-like 1 antibody, lysyl oxidase like 1 L homeolog antibody, LOXL1 antibody, loxl1 antibody, Loxl1 antibody, loxl1.L antibody

Background: LOXL1 is a member of the lysyl oxidase family. The prototypic member of the family is essential to the biogenesis of connective tissue, encoding an extracellular copper-dependent amine oxidase that catalyses the first step in the formation of crosslinks in collagens and elastin. A highly conserved amino acid sequence at the C-terminus end appears to be sufficient for amine oxidase activity, suggesting that each family member may retain this function. The N-terminus is poorly conserved and may impart additional roles in developmental regulation, senescence, tumor suppression, cell growth control, and chemotaxis to each member of the family.

Molecular Weight: 53 kDa (MW of target protein)