Fibromodulin antibody (N-Term)

Catalog No. ABIN633883

Product Details anti-Fibromodulin Antibody

Target: Fibromodulin (FMOD)

Binding Specificity: N-Term

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Fibromodulin antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Fibromodulin antibody was raised against the N terminal of FMOD

Purification: Affinity purified

Immunogen: Fibromodulin antibody was raised using the N terminal of FMOD corresponding to a region with amino acids VYFQNNQITSIQEGVFDNATGLLWIALHGNQITSDKVGRKVFSKLRHLER

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Fibromodulin Blocking Peptide, catalog no. 33R-9917, is also available for use as a blocking control in assays to test for specificity of this Fibromodulin antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FMOD antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Fibromodulin

Target: Fibromodulin (FMOD)

Alternative Name: Fibromodulin (FMOD Products)

Synonyms: FMOD antibody, AI131919 antibody, AU041740 antibody, SLRR2E antibody, LOC100286414 antibody, sc:d0415 antibody, si:dkey-31j12.4 antibody, LOC100229381 antibody, FM antibody, fibromodulin antibody, fibromodulin b antibody, FMOD antibody, Fmod antibody, LOC100286414 antibody, fmodb antibody

Background: Fibromodulin is a member of a family of small interstitial proteoglycans, containing a central region composed of leucine-rich repeats with 4 keratan sulfate chains flanked by disulfide-bonded terminal domains. It may participate in the assembly of the extracellular matrix as it interacts with type I and type II collagen fibrils and inhibits fibrillogenesis in vitro. It may also regulate TGF-beta activities by sequestering TGF-beta into the extracellular matrix.

Molecular Weight: 41 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process