ACRV1 antibody (N-Term)

Catalog No. ABIN633880

Product Details anti-ACRV1 Antibody

Target: ACRV1 (Acrosomal Vesicle Protein 1 (ACRV1))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ACRV1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ACRV1 antibody was raised against the N terminal of ACRV1

Purification: Affinity purified

Immunogen: ACRV1 antibody was raised using the N terminal of ACRV1 corresponding to a region with amino acids MNRFLLLMSLYLLGSARGTSSQPNELSGSIDHQTSVQQLPGEFFSLENPS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ACRV1 Blocking Peptide, catalog no. 33R-6263, is also available for use as a blocking control in assays to test for specificity of this ACRV1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACRV1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ACRV1

Target: ACRV1 (Acrosomal Vesicle Protein 1 (ACRV1))

Alternative Name: ACRV1 (ACRV1 Products)

Synonyms: ACRV1 antibody, D11S4365 antibody, SP-10 antibody, SPACA2 antibody, Msa63 antibody, Sp10 antibody, acrosomal vesicle protein 1 antibody, ACRV1 antibody, Acrv1 antibody

Background: ACRV1 is a testis-specific, differentiation antigen, acrosomal vesicle protein 1, that arises within the acrosomal vesicle during spermatogenesis, and is associated with the acrosomal membranes and matrix of mature sperm. The acrosomal vesicle protein 1 may be involved in sperm-zona binding or penetration, and it is a potential contraceptive vaccine immunogen for humans.

Molecular Weight: 29 kDa (MW of target protein)