AGXT2 antibody (N-Term)

Catalog No. ABIN633875

Product Details anti-AGXT2 Antibody

Target: AGXT2 (Alanine Glyoxylate Aminotransferase 2 (AGXT2))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This AGXT2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: AGXT2 antibody was raised against the N terminal of AGXT2

Purification: Affinity purified

Immunogen: AGXT2 antibody was raised using the N terminal of AGXT2 corresponding to a region with amino acids TSVTKLSLHTKPRMPPCDFMPERYQSLGYNRVLEIHKEHLSPVVTAYFQK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

AGXT2 Blocking Peptide, catalog no. 33R-9305, is also available for use as a blocking control in assays to test for specificity of this AGXT2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AGXT2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for AGXT2

Target: AGXT2 (Alanine Glyoxylate Aminotransferase 2 (AGXT2))

Alternative Name: AGXT2 (AGXT2 Products)

Synonyms: AGT2 antibody, DAIBAT antibody, AI303810 antibody, AI663818 antibody, T19P19.50 antibody, T19P19_50 antibody, alanine:glyoxylate aminotransferase 2 antibody, im:7153274 antibody, zgc:114195 antibody, alanine--glyoxylate aminotransferase 2 antibody, alanine-glyoxylate aminotransferase 2 antibody, alanine:glyoxylate aminotransferase 2 antibody, AGXT2 antibody, Agxt2 antibody, AGT2 antibody, agxt2 antibody

Background: The protein encoded by this gene is a class III pyridoxal-phosphate-dependent mitochondrial aminotransferase. It catalyzes the conversion of glyoxylate to glycine using L-alanine as the amino donor.

Molecular Weight: 52 kDa (MW of target protein)

Pathways: Monocarboxylic Acid Catabolic Process