CBLN4 antibody (C-Term)
-
- Target See all CBLN4 Antibodies
- CBLN4 (Cerebellin 4 Precursor (CBLN4))
-
Binding Specificity
- C-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CBLN4 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- CBLN4 antibody was raised against the C terminal of CBLN4
- Purification
- Affinity purified
- Immunogen
- CBLN4 antibody was raised using the C terminal of CBLN4 corresponding to a region with amino acids HVIKVYQSQTIQVNLMLNGKPVISAFAGDKDVTREAATNGVLLYLDKEDK
- Top Product
- Discover our top product CBLN4 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CBLN4 Blocking Peptide, catalog no. 33R-3868, is also available for use as a blocking control in assays to test for specificity of this CBLN4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CBLN4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CBLN4 (Cerebellin 4 Precursor (CBLN4))
- Alternative Name
- CBLN4 (CBLN4 Products)
- Background
- Cerebellin is a sixteen aa peptide found mainly in the adrenal medulla, where it has been shown to have a neuromodulatory function. Cerebellin is derived from precerebellin, a protein with sequence similarity to the noncollagen domain of complement component C1qB. CBLN4 is a glycoprotein which shares sequence similarity with precerebellin.
- Molecular Weight
- 22 kDa (MW of target protein)
-