FKBP2 antibody (N-Term)

Catalog No. ABIN633871

Product Details anti-FKBP2 Antibody

Target: FKBP2 (FK506 Binding Protein 2, 13kDa (FKBP2))

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FKBP2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: FKBP2 antibody was raised against the N terminal of FKBP2

Purification: Affinity purified

Immunogen: FKBP2 antibody was raised using the N terminal of FKBP2 corresponding to a region with amino acids RLSWFRVLTVLSICLSAVATATGAEGKRKLQIGVKKRVDHCPIKSRKGDV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FKBP2 Blocking Peptide, catalog no. 33R-8052, is also available for use as a blocking control in assays to test for specificity of this FKBP2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FKBP2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FKBP2

Target: FKBP2 (FK506 Binding Protein 2, 13kDa (FKBP2))

Alternative Name: FKBP2 (FKBP2 Products)

Synonyms: FKBP-13 antibody, PPIase antibody, FKBP12 antibody, Fkbp2 antibody, 13kDa antibody, FKBP-2 antibody, mFKBP13 antibody, mFKBP2 antibody, RGD1560660 antibody, zgc:101826 antibody, FK506 binding protein 2 antibody, FK506 binding protein 1a antibody, FK506 binding protein 2 L homeolog antibody, FKBP2 antibody, Fkbp1a antibody, Fkbp2 antibody, fkbp2 antibody, fkbp2.L antibody

Background: FKBP2 is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This protein is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin. It is thought to function as an ER chaperone and may also act as a component of membrane cytoskeletal scaffolds. Multiple alternatively spliced variants, encoding the same protein, have been identified.

Molecular Weight: 16 kDa (MW of target protein)