LAIR2 antibody (N-Term)

Catalog No. ABIN633870

Product Details anti-LAIR2 Antibody

Target: LAIR2 (Leukocyte-Associated Immunoglobulin-Like Receptor 2 (LAIR2))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LAIR2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: LAIR2 antibody was raised against the N terminal of LAIR2

Purification: Affinity purified

Immunogen: LAIR2 antibody was raised using the N terminal of LAIR2 corresponding to a region with amino acids SPHLTALLGLVLCLAQTIHTQEGALPRPSISAEPGTVISPGSHVTFMCRG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LAIR2 Blocking Peptide, catalog no. 33R-8677, is also available for use as a blocking control in assays to test for specificity of this LAIR2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LAIR2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LAIR2

Target: LAIR2 (Leukocyte-Associated Immunoglobulin-Like Receptor 2 (LAIR2))

Alternative Name: LAIR2 (LAIR2 Products)

Synonyms: CD306 antibody, leukocyte associated immunoglobulin like receptor 2 antibody, LAIR2 antibody

Background: LAIR2 is a member of the immunoglobulin superfamily. It was identified by its similarity to LAIR1, an inhibitory receptor present on mononuclear leukocytes. This gene maps to a region of 19q13.4, termed the leukocyte receptor cluster, which contains 29 genes in the immunoglobulin superfamily, including LAIR1. The function of this protein is unknown, although it is thought to be secreted and may help modulate mucosal tolerance. Two transcript variants encoding different isoforms have been found for this gene.

Molecular Weight: 16 kDa (MW of target protein)