NOMO1 antibody (N-Term)
-
- Target See all NOMO1 Antibodies
- NOMO1 (NODAL Modulator 1 (NOMO1))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Rat, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This NOMO1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- NOMO1 antibody was raised against the N terminal of NOMO1
- Purification
- Affinity purified
- Immunogen
- NOMO1 antibody was raised using the N terminal of NOMO1 corresponding to a region with amino acids DGSFRLENITTGTYTIHAQKEHLYFETVTIKIAPNTPQLADIIATGFSVC
- Top Product
- Discover our top product NOMO1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
NOMO1 Blocking Peptide, catalog no. 33R-1965, is also available for use as a blocking control in assays to test for specificity of this NOMO1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NOMO1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NOMO1 (NODAL Modulator 1 (NOMO1))
- Alternative Name
- NOMO1 (NOMO1 Products)
- Synonyms
- Nomo antibody, PM5 antibody, D7Ertd156e antibody, pM5 antibody, RGD1305240 antibody, NOMO2 antibody, DKFZP459L1733 antibody, Nomo1 antibody, NODAL modulator 1 antibody, nodal modulator 1 antibody, NOMO1 antibody, Nomo1 antibody, LOC515570 antibody, LOC714226 antibody, LOC100025365 antibody, LOC100174326 antibody, LOC100408200 antibody, LOC100464689 antibody, LOC100544619 antibody, LOC100626015 antibody, LOC454345 antibody, LOC489992 antibody, LOC100713781 antibody
- Background
- NOMO1 was originally thought to be related to the collagenase gene family. This gene is one of three highly similar genes in a region of duplication located on the p arm of chromosome 16. These three genes encode closely related proteins that may have the same function. The protein encoded by one of these genes has been identified as part of a protein complex that participates in the Nodal signaling pathway during vertebrate development. Mutations in ABCC6, which is located nearby, rather than mutations in this gene are associated with pseudoxanthoma elasticum (PXE).
- Molecular Weight
- 134 kDa (MW of target protein)
-