WNT5B antibody (Middle Region)
-
- Target See all WNT5B Antibodies
- WNT5B (Wingless-Type MMTV Integration Site Family, Member 5B (WNT5B))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This WNT5B antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- WNT5 B antibody was raised against the middle region of WNT5
- Purification
- Affinity purified
- Immunogen
- WNT5 B antibody was raised using the middle region of WNT5 corresponding to a region with amino acids YCLRNESTGSLGTQGRLCNKTSEGMDGCELMCCGRGYNQFKSVQVERCHC
- Top Product
- Discover our top product WNT5B Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
WNT5B Blocking Peptide, catalog no. 33R-10059, is also available for use as a blocking control in assays to test for specificity of this WNT5B antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WNT0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- WNT5B (Wingless-Type MMTV Integration Site Family, Member 5B (WNT5B))
- Alternative Name
- WNT5B (WNT5B Products)
- Synonyms
- wnt-5b antibody, xwnt5b antibody, WNT5B antibody, AW545702 antibody, Wnt-5b antibody, xwnt-5c antibody, CHUNP6928 antibody, id:ibd5111 antibody, ppt antibody, wnt-5 antibody, wnt5 antibody, wnt[b] antibody, wu:fk85g06 antibody, Wnt family member 5B antibody, wingless-type MMTV integration site family, member 5B antibody, Wnt family member 5B S homeolog antibody, wingless-type MMTV integration site family, member 5b antibody, wnt5b antibody, WNT5B antibody, Wnt5b antibody, wnt5b.S antibody
- Background
- The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes.
- Molecular Weight
- 39 kDa (MW of target protein)
- Pathways
- WNT Signaling, Embryonic Body Morphogenesis, Positive Regulation of fat Cell Differentiation
-