Arylsulfatase A antibody (N-Term)

Catalog No. ABIN633858

Product Details anti-Arylsulfatase A Antibody

Target: Arylsulfatase A (ARSA)

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Arylsulfatase A antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ARSA antibody was raised against the N terminal of ARSA

Purification: Affinity purified

Immunogen: ARSA antibody was raised using the N terminal of ARSA corresponding to a region with amino acids DLGCYGHPSSTTPNLDQLAAGGLRFTDFYVPVSLCTPSRAALLTGRLPVR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ARSA Blocking Peptide, catalog no. 33R-2042, is also available for use as a blocking control in assays to test for specificity of this ARSA antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARSA antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Arylsulfatase A

Target: Arylsulfatase A (ARSA)

Alternative Name: ARSA (ARSA Products)

Background: The protein encoded by this gene hydrolyzes cerebroside sulfate to cerebroside and sulfate. Defects in this gene lead to metachromatic leucodystrophy (MLD), a progressive demyelination disease which results in a variety of neurological symptoms and ultimately death. Multiple alternatively spliced transcript variants, one of which encodes a distinct protein, have been described for this gene.

Molecular Weight: 56 kDa (MW of target protein)