HS2ST1 antibody (Middle Region)

Catalog No. ABIN633850

Product Details anti-HS2ST1 Antibody

Target: HS2ST1 (Heparan Sulfate 2-O-Sulfotransferase 1 (HS2ST1))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This HS2ST1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: HS2 ST1 antibody was raised against the middle region of HS2 T1

Purification: Affinity purified

Immunogen: HS2 ST1 antibody was raised using the middle region of HS2 T1 corresponding to a region with amino acids GVTEELEDFIMLLEAALPRFFRGATELYRTGKKSHLRKTTEKKLPTKQTI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

HS2ST1 Blocking Peptide, catalog no. 33R-3656, is also available for use as a blocking control in assays to test for specificity of this HS2ST1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HS0 T1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for HS2ST1

Target: HS2ST1 (Heparan Sulfate 2-O-Sulfotransferase 1 (HS2ST1))

Alternative Name: HS2ST1 (HS2ST1 Products)

Synonyms: HS2ST1 antibody, hs2st antibody, dJ604K5.2 antibody, AW214369 antibody, Hs2st antibody, mKIAA0448 antibody, CHS2ST antibody, HS2ST antibody, 2-OST antibody, 2OST antibody, HS2st antibody, hs2st1 antibody, im:7147474 antibody, zgc:158230 antibody, heparan sulfate 2-O-sulfotransferase 1 antibody, Heparan sulfate 2-O-sulfotransferase 1 antibody, heparan sulfate 2-O-sulfotransferase 1 L homeolog antibody, heparan sulfate 2-O-sulfotransferase 1a antibody, HS2ST1 antibody, Tsp_05909 antibody, hs2st1 antibody, hs2st antibody, Hs2st1 antibody, hs2st1.L antibody, hs2st1a antibody

Background: Heparan sulfate biosynthetic enzymes are key components in generating a myriad of distinct heparan sulfate fine structures that carry out multiple biologic activities. HS2ST1 is a member of the heparan sulfate biosynthetic enzyme family that transfers sulfate to the 2 position of the iduronic acid residue of heparan sulfate. The disruption of this gene resulted in no kidney formation in knockout embryonic mice, indicating that the absence of this enzyme may interfere with the signaling required for kidney formation.

Molecular Weight: 42 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process, Tube Formation, SARS-CoV-2 Protein Interactome