PGS1 antibody (C-Term)

Catalog No. ABIN633847

Product Details anti-PGS1 Antibody

Target: PGS1 (Phosphatidylglycerophosphate Synthase 1 (PGS1))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PGS1 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: PGS1 antibody was raised against the C terminal of PGS1

Purification: Affinity purified

Immunogen: PGS1 antibody was raised using the C terminal of PGS1 corresponding to a region with amino acids QIAIVTENQALQQQLHQEQEQLYLRSGVVSSATFEQPSRQVKLWVKMVTP

Application Details

Application Notes: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PGS1 Blocking Peptide, catalog no. 33R-7584, is also available for use as a blocking control in assays to test for specificity of this PGS1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PGS1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PGS1

Target: PGS1 (Phosphatidylglycerophosphate Synthase 1 (PGS1))

Alternative Name: PGS1 (PGS1 Products)

Synonyms: 2610019F11Rik antibody, 4933424M23Rik antibody, SAF antibody, RGD1305052 antibody, phosphatidylglycerophosphate synthase 1 antibody, phosphatidylglycerophosphate synthase 1 S homeolog antibody, PGS1 antibody, Pgs1 antibody, pgs1.S antibody, pgs1 antibody

Background: PGS1 functions in the biosynthesis of the anionic phospholipids phosphatidylglycerol and cardiolipin.

Molecular Weight: 63 kDa (MW of target protein)