PLA2G5 antibody (N-Term)

Catalog No. ABIN633845

Product Details anti-PLA2G5 Antibody

Target: PLA2G5 (phospholipase A2, Group V (PLA2G5))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PLA2G5 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PLA2 G5 antibody was raised against the N terminal of PLA2 5

Purification: Affinity purified

Immunogen: PLA2 G5 antibody was raised using the N terminal of PLA2 5 corresponding to a region with amino acids MKGLLPLAWFLACSVPAVQGGLLDLKSMIEKVTGKNALTNYGFYGCYCGW

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PLA2G5 Blocking Peptide, catalog no. 33R-6140, is also available for use as a blocking control in assays to test for specificity of this PLA2G5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLA0 5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PLA2G5

Target: PLA2G5 (phospholipase A2, Group V (PLA2G5))

Alternative Name: PLA2G5 (PLA2G5 Products)

Synonyms: PLA2 antibody, sPLA2 antibody, FRFB antibody, GV-PLA2 antibody, PLA2-10 antibody, hVPLA(2) antibody, phospholipase A2 group V antibody, phospholipase A2, group V antibody, PLA2G5 antibody, Pla2g5 antibody

Background: This gene is a member of the secretory phospholipase A2 family. It is located in a tightly-linked cluster of secretory phospholipase A2 genes on chromosome 1.

Molecular Weight: 14 kDa (MW of target protein)

Pathways: Inositol Metabolic Process