ECHDC2 antibody (Middle Region)

Catalog No. ABIN633843

Product Details anti-ECHDC2 Antibody

Target: ECHDC2 (Enoyl CoA Hydratase Domain Containing 2 (ECHDC2))

Binding Specificity: Middle Region

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ECHDC2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ECHDC2 antibody was raised against the middle region of ECHDC2

Purification: Affinity purified

Immunogen: ECHDC2 antibody was raised using the middle region of ECHDC2 corresponding to a region with amino acids FVQRLRGLMNDIASSAVMGLIETTRGLLPGAGGTQRLPRCLGVALAKELI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ECHDC2 Blocking Peptide, catalog no. 33R-3118, is also available for use as a blocking control in assays to test for specificity of this ECHDC2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ECHDC2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ECHDC2

Target: ECHDC2 (Enoyl CoA Hydratase Domain Containing 2 (ECHDC2))

Alternative Name: ECHDC2 (ECHDC2 Products)

Synonyms: NV16396 antibody, id:ibd1032 antibody, wu:fc83b02 antibody, zgc:56321 antibody, zgc:85763 antibody, RGD1308525 antibody, 1300017C12Rik antibody, 2610009M20Rik antibody, D4Ertd765e antibody, enoyl-CoA hydratase domain containing 2 antibody, methylglutaconyl-CoA hydratase, mitochondrial antibody, enoyl CoA hydratase domain containing 2 antibody, enoyl Coenzyme A hydratase domain containing 2 antibody, ECHDC2 antibody, echdc2 antibody, LOC100121877 antibody, Echdc2 antibody

Background: ECHDC2 belongs to the enoyl-CoA hydratase/isomerase family. The exact function of ECHDC2 remains unknown.

Molecular Weight: 28 kDa (MW of target protein)