SERPIND1 antibody

Catalog No. ABIN633840

Product Details anti-SERPIND1 Antibody

Target: SERPIND1 (serpin Peptidase Inhibitor, Clade D (Heparin Cofactor), Member 1 (SERPIND1))

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SERPIND1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: SERPIND1 antibody was raised using a synthetic peptide corresponding to a region with amino acids VSMMQTKGNFLAANDQELDCDILQLEYVGGISMLIVVPHKMSGMKTLEAQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SERPIND1 Blocking Peptide, catalog no. 33R-9813, is also available for use as a blocking control in assays to test for specificity of this SERPIND1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SERPIND1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SERPIND1

Target: SERPIND1 (serpin Peptidase Inhibitor, Clade D (Heparin Cofactor), Member 1 (SERPIND1))

Alternative Name: SERPIND1 (SERPIND1 Products)

Synonyms: D22S673 antibody, HC2 antibody, HCF2 antibody, HCII antibody, HLS2 antibody, LS2 antibody, THPH10 antibody, serpind1 antibody, MGC53936 antibody, rls2var1 antibody, AA985900 antibody, AI303446 antibody, Hcf2 antibody, serpin family D member 1 antibody, serpin peptidase inhibitor, clade D (heparin cofactor), member 1 L homeolog antibody, serpin peptidase inhibitor, clade D (heparin cofactor), member 1 antibody, serine (or cysteine) peptidase inhibitor, clade D, member 1 antibody, SERPIND1 antibody, serpind1.L antibody, Serpind1 antibody, serpind1 antibody

Background: The product encoded by this gene is a serine proteinase inhibitor which rapidly inhibits thrombin in the presence of dermatan sulfate or heparin. The gene contains five exons and four introns.

Molecular Weight: 55 kDa (MW of target protein)