SNCA antibody

Catalog No. ABIN633838

Product Details anti-SNCA Antibody

Target: SNCA (Synuclein, alpha (SNCA))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SNCA antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: Synuclein Alpha antibody was raised using a synthetic peptide corresponding to a region with amino acids VTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKEGYQDYEPEA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Synuclein Alpha Blocking Peptide, catalog no. 33R-9853, is also available for use as a blocking control in assays to test for specificity of this Synuclein Alpha antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SNCA antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SNCA

Target: SNCA (Synuclein, alpha (SNCA))

Alternative Name: Synuclein alpha (SNCA Products)

Synonyms: snca antibody, MGC64356 antibody, LOC619283 antibody, NACP antibody, alphaSYN antibody, PARK1 antibody, PARK4 antibody, PD1 antibody, synuclein alpha L homeolog antibody, alpha-synuclein antibody, synuclein alpha antibody, synuclein, alpha antibody, snca.L antibody, LOC619283 antibody, SNCA antibody, Snca antibody

Background: Alpha-synuclein is a member of the synuclein family, which also includes beta- and gamma-synuclein. Synucleins are abundantly expressed in the brain and alpha- and beta-synuclein inhibit phospholipase D2 selectively. SNCA may serve to integrate presynaptic signaling and membrane trafficking. Defects in SNCA have been implicated in the pathogenesis of Parkinson disease. SNCA peptides are a major component of amyloid plaques in the brains of patients with Alzheimer's disease.

Molecular Weight: 11 kDa (MW of target protein)

Pathways: Synaptic Membrane, Regulation of G-Protein Coupled Receptor Protein Signaling, Positive Regulation of Endopeptidase Activity, Regulation of Carbohydrate Metabolic Process, Platelet-derived growth Factor Receptor Signaling, Negative Regulation of Transporter Activity, Regulation of long-term Neuronal Synaptic Plasticity