CHERP antibody (Middle Region)
-
- Target See all CHERP Antibodies
- CHERP (Calcium Homeostasis Endoplasmic Reticulum Protein (CHERP))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CHERP antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- CHERP antibody was raised against the middle region of CHERP
- Purification
- Affinity purified
- Immunogen
- CHERP antibody was raised using the middle region of CHERP corresponding to a region with amino acids EQGIQDPIKGGDVRDKWDQYKGVGVALDDPYENYRRNKSYSFIARMKARD
- Top Product
- Discover our top product CHERP Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CHERP Blocking Peptide, catalog no. 33R-2664, is also available for use as a blocking control in assays to test for specificity of this CHERP antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHERP antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CHERP (Calcium Homeostasis Endoplasmic Reticulum Protein (CHERP))
- Alternative Name
- CHERP (CHERP Products)
- Synonyms
- cherp antibody, MGC53695 antibody, CHERP antibody, DAN16 antibody, SCAF6 antibody, SRA1 antibody, ik:tdsubc_2h12 antibody, scaf6 antibody, wu:fc83d01 antibody, xx:tdsubc_2h12 antibody, zgc:55518 antibody, 5730408I11Rik antibody, D8Wsu96e antibody, Scaf6 antibody, calcium homeostasis endoplasmic reticulum protein S homeolog antibody, calcium homeostasis endoplasmic reticulum protein antibody, calcium homeostasis endoplasmic reticulum protein L homeolog antibody, cherp.S antibody, CHERP antibody, cherp antibody, Tsp_15667 antibody, cherp.L antibody, Cherp antibody
- Background
- CHERP is involved in calcium homeostasis, growth and proliferation.
- Molecular Weight
- 104 kDa (MW of target protein)
-