CHERP antibody (Middle Region)

Catalog No. ABIN633834

Product Details anti-CHERP Antibody

Target: CHERP (Calcium Homeostasis Endoplasmic Reticulum Protein (CHERP))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CHERP antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CHERP antibody was raised against the middle region of CHERP

Purification: Affinity purified

Immunogen: CHERP antibody was raised using the middle region of CHERP corresponding to a region with amino acids EQGIQDPIKGGDVRDKWDQYKGVGVALDDPYENYRRNKSYSFIARMKARD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CHERP Blocking Peptide, catalog no. 33R-2664, is also available for use as a blocking control in assays to test for specificity of this CHERP antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHERP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CHERP

Target: CHERP (Calcium Homeostasis Endoplasmic Reticulum Protein (CHERP))

Alternative Name: CHERP (CHERP Products)

Background: CHERP is involved in calcium homeostasis, growth and proliferation.

Molecular Weight: 104 kDa (MW of target protein)