MPPED2 antibody (C-Term)

Catalog No. ABIN633823

Product Details anti-MPPED2 Antibody

Target: MPPED2 (metallophosphoesterase Domain Containing 2 (MPPED2))

Binding Specificity: C-Term

Reactivity: Human, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MPPED2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: MPPED2 antibody was raised against the C terminal of MPPED2

Purification: Affinity purified

Immunogen: MPPED2 antibody was raised using the C terminal of MPPED2 corresponding to a region with amino acids PKLHVFGGIHEGYGIMTDGYTTYINASTCTVSFQPTNPPIIFDLPNPQGS

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MPPED2 Blocking Peptide, catalog no. 33R-7172, is also available for use as a blocking control in assays to test for specificity of this MPPED2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MPPED2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MPPED2

Target: MPPED2 (metallophosphoesterase Domain Containing 2 (MPPED2))

Alternative Name: MPPED2 (MPPED2 Products)

Synonyms: 239fb antibody, 239FB antibody, C11orf8 antibody, 239Fb antibody, 2700082O15Rik antibody, AV354767 antibody, AW060960 antibody, C11orf8h antibody, brpl antibody, cb1097 antibody, fk34e08 antibody, wu:fk34e08 antibody, zgc:56667 antibody, metallophosphoesterase domain containing 2 S homeolog antibody, metallophosphoesterase domain containing 2 antibody, metallophosphoesterase domain containing 2b antibody, mpped2.S antibody, MPPED2 antibody, Mpped2 antibody, mpped2 antibody

Background: MPPED2 protein displays low level metallophosphoesterase activity.

Molecular Weight: 33 kDa (MW of target protein)