KCNK13 antibody (C-Term)

Catalog No. ABIN633799

Product Details anti-KCNK13 Antibody

Target: KCNK13 (Potassium Channel Subfamily K Member 13 (KCNK13))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KCNK13 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: KCNK13 antibody was raised against the C terminal of KCNK13

Purification: Affinity purified

Immunogen: KCNK13 antibody was raised using the C terminal of KCNK13 corresponding to a region with amino acids GEMISMKDLLAANKASLAILQKQLSEMANGCPHQTSTLARDNEFSGGVGA

Application Details

Application Notes: WB: 0.12 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KCNK13 Blocking Peptide, catalog no. 33R-3237, is also available for use as a blocking control in assays to test for specificity of this KCNK13 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNK13 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KCNK13

Target: KCNK13 (Potassium Channel Subfamily K Member 13 (KCNK13))

Alternative Name: KCNK13 (KCNK13 Products)

Background: KCNK13 encodes one of the members of the superfamily of potassium channel proteins containing two pore-forming domains. The product of this gene is an open channel that can be stimulated by arachidonic acid.

Molecular Weight: 45 kDa (MW of target protein)