GABRR2 antibody

Catalog No. ABIN633782

Product Details anti-GABRR2 Antibody

Target: GABRR2 (gamma-aminobutyric Acid (GABA) Receptor, rho 2 (GABRR2))

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GABRR2 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: GABRR2 antibody was raised using a synthetic peptide corresponding to a region with amino acids SNKSMTFDGRLVKKIWVPDVFFVHSKRSFTHDTTTDNIMLRVFPDGHVLY

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GABRR2 Blocking Peptide, catalog no. 33R-8654, is also available for use as a blocking control in assays to test for specificity of this GABRR2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GABRR2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GABRR2

Target: GABRR2 (gamma-aminobutyric Acid (GABA) Receptor, rho 2 (GABRR2))

Alternative Name: GABRR2 (GABRR2 Products)

Synonyms: si:dkey-181i3.1 antibody, gamma-aminobutyric acid type A receptor rho2 subunit antibody, gamma-aminobutyric acid (GABA) A receptor, rho 2b antibody, gamma-aminobutyric acid type A receptor rho 2 subunit antibody, gamma-aminobutyric acid (GABA) C receptor, subunit rho 2 antibody, gamma-aminobutyric acid receptor subunit rho-2 antibody, GABRR2 antibody, gabrr2b antibody, Gabrr2 antibody, LOC100653501 antibody

Background: GABA is the major inhibitory neurotransmitter in the mammalian brain where it acts at GABA receptors, which are ligand-gated chloride channels. GABRR2 is a member of the rho subunit family and is a component of the GABA receptor complex.

Molecular Weight: 54 kDa (MW of target protein)