GABRR2 antibody
-
- Target See all GABRR2 Antibodies
- GABRR2 (gamma-aminobutyric Acid (GABA) Receptor, rho 2 (GABRR2))
-
Reactivity
- Human, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This GABRR2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- GABRR2 antibody was raised using a synthetic peptide corresponding to a region with amino acids SNKSMTFDGRLVKKIWVPDVFFVHSKRSFTHDTTTDNIMLRVFPDGHVLY
- Top Product
- Discover our top product GABRR2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
GABRR2 Blocking Peptide, catalog no. 33R-8654, is also available for use as a blocking control in assays to test for specificity of this GABRR2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GABRR2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GABRR2 (gamma-aminobutyric Acid (GABA) Receptor, rho 2 (GABRR2))
- Alternative Name
- GABRR2 (GABRR2 Products)
- Background
- GABA is the major inhibitory neurotransmitter in the mammalian brain where it acts at GABA receptors, which are ligand-gated chloride channels. GABRR2 is a member of the rho subunit family and is a component of the GABA receptor complex.
- Molecular Weight
- 54 kDa (MW of target protein)
-