ZACN antibody (N-Term)
-
- Target See all ZACN Antibodies
- ZACN (Zinc Activated Ligand-Gated Ion Channel (ZACN))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ZACN antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- LGICZ1 antibody was raised against the N terminal Of Lgicz1
- Purification
- Affinity purified
- Immunogen
- LGICZ1 antibody was raised using the N terminal Of Lgicz1 corresponding to a region with amino acids PSLFNVNLSKKVQESIQIPNNGSAPLLVDVRVFVSNVFNVDILRYTMSSM
- Top Product
- Discover our top product ZACN Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
LGICZ1 Blocking Peptide, catalog no. 33R-7358, is also available for use as a blocking control in assays to test for specificity of this LGICZ1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LGICZ1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ZACN (Zinc Activated Ligand-Gated Ion Channel (ZACN))
- Alternative Name
- LGICZ1 (ZACN Products)
- Background
- LGICZ1 is a zinc-activated ligand-gated ion channel that defines a new subgroup of the cysteine-loop superfamily of ligand-gated ion channels.LGICZ1 is a zinc-activated ligand-gated ion channel that defines a new subgroup of the cysteine-loop superfamily of ligand-gated ion channels.
- Molecular Weight
- 46 kDa (MW of target protein)
- Pathways
- Synaptic Membrane
-