GRIK2 antibody (C-Term)

Catalog No. ABIN633773

Product Details anti-GRIK2 Antibody

Target: GRIK2 (Glutamate Receptor, Ionotropic, Kainate 2 (GRIK2))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat, Dog, Zebrafish (Danio rerio)

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GRIK2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: GRIK2 antibody was raised against the C terminal of GRIK2

Purification: Affinity purified

Immunogen: GRIK2 antibody was raised using the C terminal of GRIK2 corresponding to a region with amino acids TANLAAFLTVERMESPIDSADDLAKQTKIEYGAVEDGATMTFFKKSKIST

Application Details

Application Notes: WB: 0.125 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GRIK2 Blocking Peptide, catalog no. 33R-8980, is also available for use as a blocking control in assays to test for specificity of this GRIK2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GRIK2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GRIK2

Target: GRIK2 (Glutamate Receptor, Ionotropic, Kainate 2 (GRIK2))

Alternative Name: GRIK2 (GRIK2 Products)

Synonyms: GRIK5 antibody, eaa4 antibody, glr6 antibody, gluk6 antibody, glur6 antibody, grik2 antibody, mrt6 antibody, GluR6 antibody, grik2-A antibody, EAA4 antibody, GLR6 antibody, GLUK6 antibody, GLUR6 antibody, GluK2 antibody, MRT6 antibody, AW124492 antibody, Glur-6 antibody, Glur6 antibody, Glurbeta2 antibody, GRIK2 antibody, glutamate ionotropic receptor kainate type subunit 2 antibody, glutamate receptor, ionotropic, kainate 2 L homeolog antibody, glutamate receptor, ionotropic, kainate 2 antibody, glutamate receptor, ionotropic, kainate 2 (beta 2) antibody, GRIK2 antibody, grik2.L antibody, grik2 antibody, Grik2 antibody

Background: This gene, GRIK2, encodes a subunit of a kainate glutamate receptor. Glutamate receptors mediate the majority of excitatory neurotransmission in the brain. This receptor may have a role in synaptic plasticity and may be important for learning and memory. It also may be involved in the transmission of light information from the retina to the hypothalamus. The structure and function of the encoded protein is changed by RNA editing.

Molecular Weight: 98 kDa (MW of target protein)

Pathways: Synaptic Membrane, Regulation of long-term Neuronal Synaptic Plasticity