CHRNA1 antibody
-
- Target See all CHRNA1 Antibodies
- CHRNA1 (Acetylcholine Receptor Subunit alpha (CHRNA1))
-
Reactivity
- Human, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CHRNA1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- CHRNA1 antibody was raised using a synthetic peptide corresponding to a region with amino acids AGLVLGSEHETRLVAKLFKDYSSVVRPVEDHRQVVEVTVGLQLIQLINVD
- Top Product
- Discover our top product CHRNA1 Primary Antibody
-
-
- Application Notes
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CHRNA1 Blocking Peptide, catalog no. 33R-1210, is also available for use as a blocking control in assays to test for specificity of this CHRNA1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHRNA1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CHRNA1 (Acetylcholine Receptor Subunit alpha (CHRNA1))
- Alternative Name
- CHRNA1 (CHRNA1 Products)
- Synonyms
- CHRNA1 antibody, ACHRA antibody, ACHRD antibody, CHRNA antibody, CMS2A antibody, FCCMS antibody, SCCMS antibody, NACHRA1 antibody, AI385656 antibody, AI608266 antibody, Achr-1 antibody, Acra antibody, cholinergic receptor nicotinic alpha 1 subunit antibody, cholinergic receptor, nicotinic, alpha polypeptide 1 (muscle) antibody, CHRNA1 antibody, Chrna1 antibody
- Background
- The CHRNA1 gene encodes an alpha subunit that plays a role in acetlycholine binding/channel gating.
- Molecular Weight
- 52 kDa (MW of target protein)
- Pathways
- Skeletal Muscle Fiber Development
-