KCNK4 antibody (N-Term)
-
- Target See all KCNK4 Antibodies
- KCNK4 (Potassium Channel, Subfamily K, Member 4 (KCNK4))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This KCNK4 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- KCNK4 antibody was raised against the N terminal of KCNK4
- Purification
- Affinity purified
- Immunogen
- KCNK4 antibody was raised using the N terminal of KCNK4 corresponding to a region with amino acids MRSTTLLALLALVLLYLVSGALVFRALEQPHEQQAQRELGEVREKFLRAH
- Top Product
- Discover our top product KCNK4 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
KCNK4 Blocking Peptide, catalog no. 33R-6385, is also available for use as a blocking control in assays to test for specificity of this KCNK4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNK4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KCNK4 (Potassium Channel, Subfamily K, Member 4 (KCNK4))
- Alternative Name
- KCNK4 (KCNK4 Products)
- Background
- Potassium channels play a role in many cellular processes including maintenance of the action potential, muscle contraction, hormone secretion, osmotic regulation, and ion flow. KCNK4 is one of the members of the superfamily of potassium channel proteins containing two pore-forming P domains. It homodimerizes and functions as an outwardly rectifying channel. It is expressed primarily in neural tissues and is stimulated by membrane stretch and polyunsaturated fatty acids.
- Molecular Weight
- 43 kDa (MW of target protein)
-