TPCN1 antibody (N-Term)

Catalog No. ABIN633731

Product Details anti-TPCN1 Antibody

Target: TPCN1 (Two Pore Segment Channel 1 (TPCN1))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TPCN1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TPCN1 antibody was raised against the N terminal of TPCN1

Purification: Affinity purified

Immunogen: TPCN1 antibody was raised using the N terminal of TPCN1 corresponding to a region with amino acids YQEAAIYLQEGENNDKFFTHPKDAKALAAYLFAHNHLFYLMELATALLLL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TPCN1 Blocking Peptide, catalog no. 33R-10210, is also available for use as a blocking control in assays to test for specificity of this TPCN1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TPCN1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TPCN1

Target: TPCN1 (Two Pore Segment Channel 1 (TPCN1))

Alternative Name: TPCN1 (TPCN1 Products)

Synonyms: ATCCH1 antibody, ATTPC1 antibody, CALCIUM CHANNEL 1 antibody, FATTY ACID OXYGENATION UPREGULATED 2 antibody, FOU2 antibody, T5L23.5 antibody, two-pore channel 1 antibody, 5730403B01Rik antibody, Tpc1 antibody, mKIAA1169 antibody, TPC1 antibody, si:dkey-125i10.5 antibody, two pore segment channel 1 antibody, two-pore channel 1 antibody, two pore channel 1 antibody, Tpcn1 antibody, TPC1 antibody, TPCN1 antibody, tpcn1 antibody

Background: TPCN1 may function as one of the major voltage-gated Ca2+ channel (VDCC) across the plasma membrane.Voltage-gated Ca(2+) and Na+ channels have 4 homologous domains, each containing 6 transmembrane segments, S1 to S6. TPCN1 is similar to these channels, but it has only 2 domains containing S1 to S6.

Molecular Weight: 94 kDa (MW of target protein)