TPCN1 antibody (N-Term)
-
- Target See all TPCN1 Antibodies
- TPCN1 (Two Pore Segment Channel 1 (TPCN1))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TPCN1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- TPCN1 antibody was raised against the N terminal of TPCN1
- Purification
- Affinity purified
- Immunogen
- TPCN1 antibody was raised using the N terminal of TPCN1 corresponding to a region with amino acids YQEAAIYLQEGENNDKFFTHPKDAKALAAYLFAHNHLFYLMELATALLLL
- Top Product
- Discover our top product TPCN1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
TPCN1 Blocking Peptide, catalog no. 33R-10210, is also available for use as a blocking control in assays to test for specificity of this TPCN1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TPCN1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TPCN1 (Two Pore Segment Channel 1 (TPCN1))
- Alternative Name
- TPCN1 (TPCN1 Products)
- Background
- TPCN1 may function as one of the major voltage-gated Ca2+ channel (VDCC) across the plasma membrane.Voltage-gated Ca(2+) and Na+ channels have 4 homologous domains, each containing 6 transmembrane segments, S1 to S6. TPCN1 is similar to these channels, but it has only 2 domains containing S1 to S6.
- Molecular Weight
- 94 kDa (MW of target protein)
-