CLCNKB antibody (C-Term)
-
- Target See all CLCNKB Antibodies
- CLCNKB (Chloride Channel Kb (CLCNKB))
-
Binding Specificity
- C-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CLCNKB antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- CLCNKB antibody was raised against the C terminal of CLCNKB
- Purification
- Affinity purified
- Immunogen
- CLCNKB antibody was raised using the C terminal of CLCNKB corresponding to a region with amino acids ILAAGCPTEPVTLKLSPETSLHEAHNLFELLNLHSLFVTSRGRAVGCVSW
- Top Product
- Discover our top product CLCNKB Primary Antibody
-
-
- Application Notes
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CLCNKB Blocking Peptide, catalog no. 33R-4035, is also available for use as a blocking control in assays to test for specificity of this CLCNKB antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLCNKB antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CLCNKB (Chloride Channel Kb (CLCNKB))
- Alternative Name
- CLCNKB (CLCNKB Products)
- Synonyms
- CLCNKA antibody, CLCNKB antibody, DKFZp469N0132 antibody, CLCKB antibody, Clc-Ka antibody, Clck2 antibody, Clcnk1l antibody, ClC-K2L antibody, ClC-K2 antibody, ClC-Kb antibody, ClC-k antibody, clc-kb antibody, clckb antibody, clcnka-A antibody, clk-k2 antibody, x6clck antibody, xCIC-K antibody, xClC-K antibody, zgc:64141 antibody, Clcnkb antibody, chloride voltage-gated channel Kb antibody, chloride channel Kb antibody, chloride channel, voltage-sensitive Kb antibody, chloride channel, voltage-sensitive Kb L homeolog antibody, chloride channel K antibody, chloride channel protein ClC-Ka antibody, chloride channel protein ClC-Kb antibody, CLCNKB antibody, Clcnkb antibody, clcnkb.L antibody, clcnk antibody, LOC100017912 antibody, LOC100400180 antibody, LOC100590605 antibody, LOC100730738 antibody
- Background
- Chloride channel Kb (CLCNKB) is a member of the CLC family of voltage-gated chloride channels, which comprises at least 9 mammalian chloride channels. Each is believed to have 12 transmembrane domains and intracellular N and C termini. Mutations in CLCNKB result in the autosomal recessive Type III Bartter Syndrome. CLCNKA and CLCNKB are closely related (94% sequence identity), tightly linked (separated by 11 kb of genomic sequence) and are both expressed in mammalian kidney.
- Molecular Weight
- 76 kDa (MW of target protein)
-