CLCNKB antibody (C-Term)

Catalog No. ABIN633720

Product Details anti-CLCNKB Antibody

Target: CLCNKB (Chloride Channel Kb (CLCNKB))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CLCNKB antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CLCNKB antibody was raised against the C terminal of CLCNKB

Purification: Affinity purified

Immunogen: CLCNKB antibody was raised using the C terminal of CLCNKB corresponding to a region with amino acids ILAAGCPTEPVTLKLSPETSLHEAHNLFELLNLHSLFVTSRGRAVGCVSW

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CLCNKB Blocking Peptide, catalog no. 33R-4035, is also available for use as a blocking control in assays to test for specificity of this CLCNKB antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLCNKB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CLCNKB

Target: CLCNKB (Chloride Channel Kb (CLCNKB))

Alternative Name: CLCNKB (CLCNKB Products)

Background: Chloride channel Kb (CLCNKB) is a member of the CLC family of voltage-gated chloride channels, which comprises at least 9 mammalian chloride channels. Each is believed to have 12 transmembrane domains and intracellular N and C termini. Mutations in CLCNKB result in the autosomal recessive Type III Bartter Syndrome. CLCNKA and CLCNKB are closely related (94% sequence identity), tightly linked (separated by 11 kb of genomic sequence) and are both expressed in mammalian kidney.

Molecular Weight: 76 kDa (MW of target protein)