MCOLN1 antibody (N-Term)

Catalog No. ABIN633712

Product Details anti-MCOLN1 Antibody

Target: MCOLN1 (Mucolipin 1 (MCOLN1))

Binding Specificity: N-Term

Reactivity: Human, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MCOLN1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Mucolipin 1 antibody was raised against the N terminal of MCOLN1

Purification: Affinity purified

Immunogen: Mucolipin 1 antibody was raised using the N terminal of MCOLN1 corresponding to a region with amino acids FRHLFLLGYSDGADDTFAAYTREQLYQAIFHAVDQYLALPDVSLGRYAYV

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Mucolipin 1 Blocking Peptide, catalog no. 33R-3049, is also available for use as a blocking control in assays to test for specificity of this Mucolipin 1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MCOLN1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MCOLN1

Target: MCOLN1 (Mucolipin 1 (MCOLN1))

Alternative Name: Mucolipin 1 (MCOLN1 Products)

Synonyms: mcoln1 antibody, mcoln1.1 antibody, zgc:63619 antibody, mln1 antibody, mucolipin-1 antibody, MCOLN1 antibody, MG-2 antibody, ML4 antibody, MLIV antibody, MST080 antibody, TRP-ML1 antibody, TRPM-L1 antibody, TRPML1 antibody, 2210015I05Rik antibody, mucolipidin antibody, mucolipin 1a antibody, mucolipin 1 antibody, mucolipin 1 L homeolog antibody, mcoln1a antibody, MCOLN1 antibody, mcoln1.L antibody, mcoln1 antibody, LOAG_04987 antibody, Mcoln1 antibody

Background: MCOLN1 encodes a protein that may be involved in calcium signaling and membrane trafficking in mucolipidosis IV.

Molecular Weight: 64 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis