Bestrophin 3 antibody (N-Term)

Catalog No. ABIN633708

Product Details anti-Bestrophin 3 Antibody

Target: Bestrophin 3 (BEST3)

Binding Specificity: N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Bestrophin 3 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: BEST3 antibody was raised against the N terminal of BEST3

Purification: Affinity purified

Immunogen: BEST3 antibody was raised using the N terminal of BEST3 corresponding to a region with amino acids PLVYTQVAEQLINPFGEDDDDFETNWCIDRNLQVSLLAVDEMHMSLPKMK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

BEST3 Blocking Peptide, catalog no. 33R-7214, is also available for use as a blocking control in assays to test for specificity of this BEST3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BEST3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Bestrophin 3

Target: Bestrophin 3 (BEST3)

Alternative Name: BEST3 (BEST3 Products)

Synonyms: CG12327 antibody, Dmel\\CG12327 antibody, dbest3 antibody, best-3 antibody, BEST3 antibody, VMD2L3 antibody, Vmd2l3 antibody, mBest4 antibody, bestrophin-3 antibody, bestrophin 3 antibody, Bestrophin 3 antibody, BEST3 antibody, Best3 antibody, best3 antibody

Background: BEST3 belongs to the bestrophin family of anion channels, which includes BEST1, the gene mutant in vitelliform macular dystrophy, and 2 other BEST1-like genes, BEST2 and BEST4.

Molecular Weight: 51 kDa (MW of target protein)