KCNN2 antibody (Middle Region)
-
- Target See all KCNN2 Antibodies
- KCNN2 (Potassium Intermediate/small Conductance Calcium-Activated Channel, Subfamily N, Member 2 (KCNN2))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This KCNN2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- KCNN2 antibody was raised against the middle region of KCNN2
- Purification
- Affinity purified
- Immunogen
- KCNN2 antibody was raised using the middle region of KCNN2 corresponding to a region with amino acids KNAAANVLRETWLIYKNTKLVKKIDHAKVRKHQRKFLQAIHQLRSVKMEQ
- Top Product
- Discover our top product KCNN2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
KCNN2 Blocking Peptide, catalog no. 33R-4564, is also available for use as a blocking control in assays to test for specificity of this KCNN2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNN2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KCNN2 (Potassium Intermediate/small Conductance Calcium-Activated Channel, Subfamily N, Member 2 (KCNN2))
- Alternative Name
- KCNN2 (KCNN2 Products)
- Synonyms
- KCNN2 antibody, SK2 antibody, KCa2.2 antibody, SKCA2 antibody, SKCa 2 antibody, hSK2 antibody, fri antibody, potassium calcium-activated channel subfamily N member 2 antibody, potassium intermediate/small conductance calcium-activated channel, subfamily N, member 2 antibody, KCNN2 antibody, Kcnn2 antibody
- Background
- KCNN2 is an integral membrane protein that forms a voltage-independent calcium-activated channel with three other calmodulin-binding subunits. This protein is a member of the KCNN family of potassium channel genes. Two transcript variants encoding different isoforms have been found for KCNN2.
- Molecular Weight
- 26 kDa (MW of target protein)
-