-
- Target See all ACCN1 Antibodies
- ACCN1 (Amiloride-Sensitive Cation Channel 1, Neuronal (ACCN1))
-
Reactivity
- Human, Dog
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ACCN1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- ACCN1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GDIGGQMGLFIGASILTILELFDYIYELIKEKLLDLLGKEEDEGSHDENV
- Top Product
- Discover our top product ACCN1 Primary Antibody
-
anti-Amiloride-Sensitive Cation Channel 1, Neuronal (ACCN1) (AA 197-345) antibody
ACCN1 Reactivity: Human ELISA, IHC, IF Host: Rabbit Polyclonal unconjugated
anti-Amiloride-Sensitive Cation Channel 1, Neuronal (ACCN1) (AA 120-148) antibodyACCN1 Reactivity: Human WB, FACS, IHC (p) Host: Rabbit Polyclonal RB22513 unconjugated
anti-Amiloride-Sensitive Cation Channel 1, Neuronal (ACCN1) (AA 481-530) antibodyACCN1 Reactivity: Human, Horse, Rabbit, Monkey, Bat WB, IHC, IHC (p) Host: Rabbit Polyclonal unconjugated
anti-Amiloride-Sensitive Cation Channel 1, Neuronal (ACCN1) (AA 127-156), (Middle Region) antibodyACCN1 Reactivity: Human WB, IHC (p), EIA Host: Rabbit Polyclonal unconjugated
anti-Amiloride-Sensitive Cation Channel 1, Neuronal (ACCN1) (C-Term) antibodyACCN1 Reactivity: Human, Rat, Mouse, Horse, Rabbit, Cow, Zebrafish (Danio rerio), Monkey, Chicken WB Host: Rabbit Polyclonal unconjugated
anti-Amiloride-Sensitive Cation Channel 1, Neuronal (ACCN1) (AA 120-400) antibodyACCN1 Reactivity: Human WB Host: Rabbit Polyclonal unconjugated
anti-Amiloride-Sensitive Cation Channel 1, Neuronal (ACCN1) (AA 120-148) antibodyACCN1 Reactivity: Human WB, ELISA, IHC, FACS Host: Rabbit Polyclonal unconjugated
anti-Amiloride-Sensitive Cation Channel 1, Neuronal (ACCN1) (AA 2-18), (Intracellular), (N-Term) antibodyACCN1 Reactivity: Human, Rat, Mouse WB, IHC, IF, ICC, IP Host: Rabbit Polyclonal unconjugated
-
- Application Notes
-
WB: 2 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ACCN1 Blocking Peptide, catalog no. 33R-3197, is also available for use as a blocking control in assays to test for specificity of this ACCN1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACCN1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ACCN1 (Amiloride-Sensitive Cation Channel 1, Neuronal (ACCN1))
- Alternative Name
- ACCN1 (ACCN1 Products)
- Synonyms
- ACCN antibody, ACCN1 antibody, ASIC2a antibody, BNC1 antibody, BNaC1 antibody, MDEG antibody, hBNaC1 antibody, ACIC2 antibody, Accn1 antibody, BNaC1a antibody, Mdeg antibody, BNC1k antibody, MDEG1 antibody, MDEG2 antibody, accn1 antibody, zASIC2 antibody, acid sensing ion channel subunit 2 antibody, acid-sensing (proton-gated) ion channel 2 antibody, ASIC2 antibody, Asic2 antibody, asic2 antibody
- Background
- ACCN1 is a member of the degenerin/epithelial sodium channel (DEG/ENaC) superfamily. ACCN1 may play a role in neurotransmission. In addition, a heteromeric association between ACCN1 and ACCN3 (variant 1) has been observed to co-assemble into proton-gated channels sensitive to gadolinium.
- Molecular Weight
- 63 kDa (MW of target protein)
- Pathways
- Sensory Perception of Sound
-
You are here:
