ACCN1 antibody

Catalog No. ABIN633674

Product Details anti-ACCN1 Antibody

Target: ACCN1 (Amiloride-Sensitive Cation Channel 1, Neuronal (ACCN1))

Reactivity: Human, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ACCN1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: ACCN1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GDIGGQMGLFIGASILTILELFDYIYELIKEKLLDLLGKEEDEGSHDENV

Application Details

Application Notes: WB: 2 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ACCN1 Blocking Peptide, catalog no. 33R-3197, is also available for use as a blocking control in assays to test for specificity of this ACCN1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACCN1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ACCN1

Target: ACCN1 (Amiloride-Sensitive Cation Channel 1, Neuronal (ACCN1))

Alternative Name: ACCN1 (ACCN1 Products)

Background: ACCN1 is a member of the degenerin/epithelial sodium channel (DEG/ENaC) superfamily. ACCN1 may play a role in neurotransmission. In addition, a heteromeric association between ACCN1 and ACCN3 (variant 1) has been observed to co-assemble into proton-gated channels sensitive to gadolinium.

Molecular Weight: 63 kDa (MW of target protein)

Pathways: Sensory Perception of Sound