P2RX7 antibody (Middle Region)
-
- Target See all P2RX7 Antibodies
- P2RX7 (Purinergic Receptor P2X, Ligand-Gated Ion Channel, 7 (P2RX7))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This P2RX7 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- P2 RX7 antibody was raised against the middle region of P2 X7
- Purification
- Affinity purified
- Immunogen
- P2 RX7 antibody was raised using the middle region of P2 X7 corresponding to a region with amino acids VKEEIVENGVKKLVHSVFDTADYTFPLQGNSFFVMTNFLKTEGQEQRLCP
- Top Product
- Discover our top product P2RX7 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
P2RX7 Blocking Peptide, catalog no. 33R-9617, is also available for use as a blocking control in assays to test for specificity of this P2RX7 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of P0 X7 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- P2RX7 (Purinergic Receptor P2X, Ligand-Gated Ion Channel, 7 (P2RX7))
- Alternative Name
- P2RX7 (P2RX7 Products)
- Synonyms
- p2xr7 antibody, P2RX7 antibody, P2X7 antibody, AI467586 antibody, P2X(7) antibody, P2X7R antibody, p2x7 antibody, purinergic receptor P2X 7 antibody, purinergic receptor P2X, ligand-gated ion channel, 7 antibody, P2X purinoceptor 7 antibody, P2RX7 antibody, p2rx7 antibody, LOC100458463 antibody, P2rx7 antibody
- Background
- The product P2RX7 belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel and is responsible for ATP-dependent lysis of macrophages through the formation of membrane pores permeable to large molecules. Activation of this nuclear receptor by ATP in the cytoplasm may be a mechanism by which cellular activity can be coupled to changes in gene expression.
- Molecular Weight
- 16 kDa (MW of target protein)
- Pathways
- Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Synaptic Vesicle Exocytosis
-