KCTD4 antibody (N-Term)

Catalog No. ABIN633664

Product Details anti-KCTD4 Antibody

Target: KCTD4 (BTB (POZ) Domain-Containing Protein KCTD4 (KCTD4))

Binding Specificity: N-Term

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KCTD4 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: KCTD4 antibody was raised against the N terminal of KCTD4

Purification: Affinity purified

Immunogen: KCTD4 antibody was raised using the N terminal of KCTD4 corresponding to a region with amino acids MTLNVGGYLYITQKQTLTKYPDTFLEGIVNGKILCPFDADGHYFIDRDGL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KCTD4 Blocking Peptide, catalog no. 33R-6554, is also available for use as a blocking control in assays to test for specificity of this KCTD4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCTD4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KCTD4

Target: KCTD4 (BTB (POZ) Domain-Containing Protein KCTD4 (KCTD4))

Alternative Name: KCTD4 (KCTD4 Products)

Synonyms: bA321C24.3 antibody, 2210017A09Rik antibody, AU017169 antibody, wu:fk37b10 antibody, zgc:92463 antibody, potassium channel tetramerization domain containing 4 antibody, potassium channel tetramerisation domain containing 4 antibody, KCTD4 antibody, Kctd4 antibody, kctd4 antibody

Background: KCTD4 contains 1 BTB (POZ) domain. The exact function of KCTD4 remains unknown.

Molecular Weight: 30 kDa (MW of target protein)