ACCN4 antibody (N-Term)

Catalog No. ABIN633663

Product Details anti-ACCN4 Antibody

Target: ACCN4 (Amiloride-Sensitive Cation Channel 4, Pituitary (ACCN4))

Binding Specificity: N-Term

Reactivity: Human, Rat, Mouse, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ACCN4 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ACCN4 antibody was raised against the N terminal of ACCN4

Purification: Affinity purified

Immunogen: ACCN4 antibody was raised using the N terminal of ACCN4 corresponding to a region with amino acids SPSSRGQMPIEIVCKIKFAEEDAKPKEKEAGDEQSLLGAVAPGAAPRDLA

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ACCN4 Blocking Peptide, catalog no. 33R-8696, is also available for use as a blocking control in assays to test for specificity of this ACCN4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACCN4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ACCN4

Target: ACCN4 (Amiloride-Sensitive Cation Channel 4, Pituitary (ACCN4))

Alternative Name: ACCN4 (ACCN4 Products)

Synonyms: ACCN4 antibody, BNAC4 antibody, Accn4 antibody, Spasic antibody, acid sensing ion channel subunit family member 4 S homeolog antibody, acid sensing ion channel subunit family member 4 antibody, acid-sensing (proton-gated) ion channel family member 4 antibody, asic4.S antibody, ASIC4 antibody, Asic4 antibody

Background: ACCN4 belongs to the superfamily of acid-sensing ion channels, which are proton-gated, amiloride-sensitive sodium channels. These channels have been implicated in synaptic transmission, pain perception as well as mechanoperception. ACCN4 is predominantly expressed in the pituitary gland, and might be a candidate for paroxysmal dystonic choreoathetosis (PDC), a movement disorder.

Molecular Weight: 46 kDa (MW of target protein)