KCTD13 antibody (N-Term)

Catalog No. ABIN633662

Product Details anti-KCTD13 Antibody

Target: KCTD13 (Potassium Channel Tetramerisation Domain Containing 13 (KCTD13))

Binding Specificity: N-Term

Reactivity: Human, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KCTD13 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificity: KCTD13 antibody was raised against the N terminal of KCTD13

Purification: Affinity purified

Immunogen: KCTD13 antibody was raised using the N terminal of KCTD13 corresponding to a region with amino acids PGPAAYGLKPLTPNSKYVKLNVGGSLHYTTLRTLTGQDTMLKAMFSGRVE

Application Details

Application Notes: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KCTD13 Blocking Peptide, catalog no. 33R-7119, is also available for use as a blocking control in assays to test for specificity of this KCTD13 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCTD13 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KCTD13

Target: KCTD13 (Potassium Channel Tetramerisation Domain Containing 13 (KCTD13))

Alternative Name: KCTD13 (KCTD13 Products)

Synonyms: KCTD13 antibody, zgc:153421 antibody, 1500003N18Rik antibody, AV259508 antibody, PDIP1alpha antibody, Pdip1 antibody, Poldip1 antibody, PDIP1 antibody, POLDIP1 antibody, hBACURD1 antibody, potassium channel tetramerization domain containing 13 antibody, potassium channel tetramerisation domain containing 13 antibody, KCTD13 antibody, kctd13 antibody, Kctd13 antibody

Background: KCTD13 mRNA is expressed in 3T3-L1 adipocytes and THP-1 macrophages. It is suggested that this gene provides a link between cytokine activation and DNA replication in liver as well as in other tissues.

Molecular Weight: 36 kDa (MW of target protein)