KCTD7 antibody (N-Term)

Catalog No. ABIN633658

Product Details anti-KCTD7 Antibody

Target: KCTD7 (Potassium Channel Tetramerisation Domain Containing 7 (KCTD7))

Binding Specificity: N-Term

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KCTD7 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: KCTD7 antibody was raised against the N terminal of KCTD7

Purification: Affinity purified

Immunogen: KCTD7 antibody was raised using the N terminal of KCTD7 corresponding to a region with amino acids VVVTGREPDSRRQDGAMSSSDAEDDFLEPATPTATQAGHALPLLPQEFPE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KCTD7 Blocking Peptide, catalog no. 33R-9904, is also available for use as a blocking control in assays to test for specificity of this KCTD7 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCTD7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KCTD7

Target: KCTD7 (Potassium Channel Tetramerisation Domain Containing 7 (KCTD7))

Alternative Name: KCTD7 (KCTD7 Products)

Synonyms: 4932409E18 antibody, 9430010P06Rik antibody, zgc:136884 antibody, CLN14 antibody, EPM3 antibody, potassium channel tetramerization domain containing 7 antibody, potassium channel tetramerisation domain containing 7 antibody, KCTD7 antibody, Kctd7 antibody, kctd7 antibody

Background: The KCTD gene family, including KCTD7, encode predicted proteins that contain N-terminal domain that is homologous to the T1 domain in voltage-gated potassium channels. KCTD7 displays a primary sequence and hydropathy profile indicating intracytoplasmic localization. EST database analysis showed that KCTD7 is expressed in human and mouse brain.

Molecular Weight: 33 kDa (MW of target protein)