SHROOM2 antibody (Middle Region)
-
- Target See all SHROOM2 Antibodies
- SHROOM2 (Shroom Family Member 2 (SHROOM2))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SHROOM2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- SHROOM2 antibody was raised against the middle region of SHROOM2
- Purification
- Affinity purified
- Immunogen
- SHROOM2 antibody was raised using the middle region of SHROOM2 corresponding to a region with amino acids CTSPPGLSYMKAKEKTVEDLKSEELAREIVGKDKSLADILDPSVKIKTTM
- Top Product
- Discover our top product SHROOM2 Primary Antibody
-
anti-Shroom Family Member 2 (SHROOM2) (AA 1554-1616) antibody
SHROOM2 Reactivity: Human WB, IHC, IHC (p) Host: Rabbit Polyclonal unconjugated
anti-Shroom Family Member 2 (SHROOM2) (C-Term) antibodySHROOM2 Reactivity: Human WB, IHC (p), IHC (fro) Host: Rabbit Polyclonal unconjugated
anti-Shroom Family Member 2 (SHROOM2) (AA 213-405) antibodySHROOM2 Reactivity: Human ELISA, IHC, IF Host: Rabbit Polyclonal unconjugated
anti-Shroom Family Member 2 (SHROOM2) (AA 599-625) antibodySHROOM2 Reactivity: Human WB Host: Rabbit Polyclonal RB37634 unconjugated
anti-Shroom Family Member 2 (SHROOM2) (C-Term) antibodyVerified SHROOM2 Reactivity: Human ELISA, IHC Host: Goat Polyclonal unconjugated
anti-Shroom Family Member 2 (SHROOM2) (AA 1295-1344) antibodySHROOM2 Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Chicken, Monkey, Pig WB Host: Rabbit Polyclonal unconjugated
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SHROOM2 Blocking Peptide, catalog no. 33R-1824, is also available for use as a blocking control in assays to test for specificity of this SHROOM2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SHROOM2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SHROOM2 (Shroom Family Member 2 (SHROOM2))
- Alternative Name
- SHROOM2 (SHROOM2 Products)
- Synonyms
- SHROOM2 antibody, APXL antibody, apxl antibody, shrm2 antibody, HSAPXL antibody, 4832440C16 antibody, Apxl antibody, C630003H05Rik antibody, Shrm2 antibody, shroom family member 2 antibody, SHROOM2 antibody, shroom2 antibody, Shroom2 antibody
- Background
- SHROOM2 shares significant similarities with the apical protein from Xenopus laevis which is implicated in amiloride-sensitive sodium channel activity. This gene is a strong candidate gene for ocular albinism type 1 syndrome.
- Molecular Weight
- 176 kDa (MW of target protein)
- Pathways
- Cell-Cell Junction Organization, Asymmetric Protein Localization
-
