ACCN4 antibody (Middle Region)
-
- Target See all ACCN4 Antibodies
- ACCN4 (Amiloride-Sensitive Cation Channel 4, Pituitary (ACCN4))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ACCN4 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- ACCN4 antibody was raised against the middle region of ACCN4
- Purification
- Affinity purified
- Immunogen
- ACCN4 antibody was raised using the middle region of ACCN4 corresponding to a region with amino acids NLTRYGKEISMVRIPNRGSARYLARKYNRNETYIRENFLVLDVFFEALTS
- Top Product
- Discover our top product ACCN4 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ACCN4 Blocking Peptide, catalog no. 33R-6782, is also available for use as a blocking control in assays to test for specificity of this ACCN4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACCN4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ACCN4 (Amiloride-Sensitive Cation Channel 4, Pituitary (ACCN4))
- Alternative Name
- ACCN4 (ACCN4 Products)
- Synonyms
- ACCN4 antibody, BNAC4 antibody, Accn4 antibody, Spasic antibody, acid sensing ion channel subunit family member 4 S homeolog antibody, acid sensing ion channel subunit family member 4 antibody, acid-sensing (proton-gated) ion channel family member 4 antibody, asic4.S antibody, ASIC4 antibody, Asic4 antibody
- Background
- ACCN4 belongs to the superfamily of acid-sensing ion channels, which are proton-gated, amiloride-sensitive sodium channels. These channels have been implicated in synaptic transmission, pain perception as well as mechanoperception. ACCN4 is predominantly expressed in the pituitary gland, and might be a candidate for paroxysmal dystonic choreoathetosis (PDC), a movement disorder.
- Molecular Weight
- 73 kDa (MW of target protein)
-